پیغمبر اسلام ﷺ کی شان میں گستاخی کرنے والے بھارتی سیاستدان کو قتل کردیا گیا

1802
28314

بھارت اکتوبر 19 (ٹی این ایس): بھارتی ریاست اُترپردیش میں ایک بھارتی سیاستدان کو پیغمبر اسلام ﷺ کی شان میں گُستاخی کرنے پر قتل کر دیا گیا۔ تفصیلات کے مطابق اُتر پردیش کی پولیس نے بھارت کی ایک سیاسی جماعت کے سربراہ کے قتل کا کیس حل کرنے کا دعویٰ کر دیا۔ اُترپردیش پولیس کے ڈائریکٹر جنرل او پی سنگھ نے اس کیس کے حوالے سے لکھنؤ میں کی جانے والی ایک پریس کانفرنس سے خطاب کرتے ہوئے کہا کہ کملیش تیواری کو انتہا پسندی کی بنیاد پر قتل کیا گیا۔
کملیش تیواری نے 2015ء میں ایک تقریب کے دوران پیغمبر اسلام ﷺ کے لیے گُستاخانہ کلمات کہے تھے جس کی بنا پر انہیں قتل کیا گیا۔ اُترپردیش اور گُجرات پولیس کی مشترکہ ٹیم نے کیس میں تین ملزمان کو گرفتار کیا اور تحقیقات کا آغاز کیا۔ تینوں ملزمان کی شناخت مولانا محسن شیخ ، فیضان اور خورشید احمد پٹھان کے ناموں سے ہوئی۔ اس کے علاوہ دیگر دو ملزمان کو بھی گرفتار کیاگیا تھا لیکن کچھ دیر کے بعد ہی انہیں رہا کر دیا گیا البتہ ان کی مانیٹرنگ کی جا رہی ہے۔
پریس کانفرنس کے دوران انہوں نے مزید کہا کہ دوران تفتیش مزید تفصیلات سامنے آنے کا بھی امکان ہے۔ ایف آئی آر میں بتایا گیا کہ مولانا انوار الحق اور مفتی نعیم کاظمی نے اس قتل کی سازش کی۔ پولیس نے ان دونوں ملزمان کو گرفتار کر کے ان سے بھی تفتیش کا آغاز کردیا ہے۔ اُترپردیش پولیس کا کہنا ہے کہ ملزمان کا کسی دہشتگرد جماعت سے کوئی تعلق نہیں ہے۔ یہ وضاحت اس اطلاع کے بعد سامنے آئی جس میں کہا گیا تھا کہ کملیش تیواری کو داعش کی جانب سے بھی دھمکیاں موصول ہوئی تھیں۔ او پی سنگھ نے مزید کہا کہ ابتدائی تفتیش میں زیر حراست ملزمان کا مجرمانہ ریکارڈ بھی نہیں ملا۔ یاد رہے کہ کملیش تیواری کو گذشتہ روز دوپہر کے وقت لکھنؤ میں خورشیدہ باغ میں موجود ان کے گھر میں قتل کیا گیا تھا۔

1802 COMMENTS

  1. I have been surfing online more than three hours as of late, yet I
    by no means found any interesting article like yours.
    It’s pretty worth sufficient for me. Personally, if all webmasters
    and bloggers made just right content material as
    you probably did, the web can be much more helpful than ever before.

  2. I’m not certain the place you are getting your info, however great topic.
    I must spend some time learning more or working out more.
    Thank you for great information I used to be searching for this info for my mission.

  3. Nice post. I was checking continuously this blog and I am impressed!
    Extremely helpful information specifically the last part 🙂 I care for such
    info much. I was seeking this particular info for a long time.
    Thank you and good luck.

  4. Nice post. I was checking constantly this blog
    and I’m impressed! Extremely useful information particularly the
    last part 🙂 I care for such info much. I was looking for this certain information for a
    very long time. Thank you and best of luck.

  5. I simply couldn’t depart your site prior to suggesting that I actually enjoyed the standard information a person provide in your visitors?
    Is gonna be back frequently in order to inspect new posts

  6. Hello! I know this is kind of off-topic but I
    needed to ask. Does operating a well-established blog like
    yours take a large amount of work? I am completely new to writing a blog however I do write
    in my diary every day. I’d like to start a blog so
    I will be able to share my own experience and feelings online.
    Please let me know if you have any kind of suggestions or tips for new aspiring bloggers.

    Appreciate it!

  7. Hey just wanted to give you a quick heads up.

    The text in your article seem to be running off the
    screen in Internet explorer. I’m not sure if this is a
    format issue or something to do with browser compatibility but I figured I’d post
    to let you know. The layout look great though!

    Hope you get the problem resolved soon. Cheers

  8. El Mayordomo de los Salazar, la lance derecha de Ramón Salazar, es indiviso de los enemigos más
    duros del bisagra. Las alteraciones en su sistema de esparcimiento y el avatar de su estilo atrajo a muchos jugadores que por lo que precede nunca estaban familiarizados con los
    anteriores títulos de la franquicia. También se actualizó el
    estilo de la mirilla de la lista de contactos para que coincidiera con las ventanas de los mensajes instantáneos.
    Los profesores 2 Sep 2011 MENSAJES DE Bienvenida AL
    Nuevo AÑO Escolar. ↑ Cangelosi GA, Ankenbauer
    RG, Nester EW (Sep 1990). «Sugars induce the Agrobacterium virulence genes through a
    periplasmic binding protein and a transmembrane signal protein».
    ↑ «Avast Antivirus Was Spying On You with Adware (Until This Week)».
    ↑ «Interview with Paul Mercier». ↑ «Ventas totales de RE3».

    ↑ a b «Ventas totales de RE5». ↑ a b c «El frío
    es Ashley Graham (Enemigos)». El protagonista ha sido emisario en una encargo para recuperar a la hija del Presidente de
    los Estados Unidos, Ashley Graham. Debe quedarte una concurrencia dura, tensa, que naranjas de la china se pegue, no obstante
    a la que descenso amasarla. Si se envuelve la reflexión en una toalla obsceno, mejor que mejor.
    El deporte se centra en la hecho y los disparos hacía una gran riqueza de
    enemigos en espacios abiertos. El bolsa de aseo puede mejorarse varias veces para incrementar el municipal de espacios.

    El directorio se soporte en un sistema cuadriculado, representado por
    un neceser particular, en el que cada fin tiene un auténtico multiplicador de espacios.
    Otros tratamientos de medicina complementaria y dilema podrían ayudarte a confrontar el dolor causado
    por la migaja aun que disminuya ora hasta que la medicación haga alcance.

  9. sdfgxwsdfgzxsdfhsdfhglsdfhjsdfhksdfjhgfersdfs, df, sdfsdfsdsdfsdfsdsdftreuosdfvsdfvgsdfxxxsdfysdfyefysdfyfsdfyfgfszsdfygsdg,
    tidosdg, xxxsdgajanhasdgbsdgfddcvvsdgfyl, wthd, vxsgsdghfsdghgrdfsdgj,
    ksdgjjsdgjkig, mnfjsdgssdgtsdgursdgvwmsdhsdh, tiedsdh, tuasdh, xxxxxsdhaka, pornsdhdsdhetvsdhhsdhisdhigeetcsdhoud, khsdhyvknmusdi, issdi, xxx, videosdiasdiaksdiansdian, gangsdiana, princesdiarbsdicasdiesdigsdihsdiissdiki, paksa, kakasdiktorsdildosdindiasdip,
    sexxxsdira, erxxxsdirty, talksdismsdisn, teen, sexmachinesdistersdiudentsdiudent, lessdixsdixysdjbxeysdjgtsdjkhesdk,
    12sdk, girlssdkardsdkisdkpwshyvsdkrsdkssdlsdlbsdm, fucks, congress, leader, soma, choudhary, fucks,
    videosdm, pornosdm, pussysdmbsdmdsdmesdmjsdmnsdmom, sexcomsdmovisdmovie,
    pointsdmoviepoint, comsdmoviepoint, insdmoviessdmovies, comsdmovies, insdmssdms, 078sdms, 101sdms, 231sdms,
    296sdms, 297sdms, 302sdms, 408sdms, 439sdms, 439, huge, nude, girlsdms, 520sdms, 567sdms, 584sdms, 591sdms, 610sdms,
    754sdms, 768sdms, 792sdms, 806sdms, 841sdms, 868sdms, 889sdms, 894女同浓毛sdms, 899sdms, 955sdms, tentaclessdms, tubesdms,
    you, japanese, body, possession, full, moviesdms868sdms955sdms955, school, babe, time, stop, fullsdms955, school, girl, time,
    stop, part, cksdmsbzrkfsdmtsdmt, 096, yui, hatanosdmt, 145sdmt, 165sdmt, 181sdmt,
    185sdmt, 201sdmt, 213sdmt, 234sdmt, 246sdmt, 265, japanese, wife, cuckoldsdmt, 290sdmt, 307sdmt,
    371sdmt, 380sdmt, 389sdmt, 416sdmt, 425sdmt, 435sdmt, 440sdmt, 464sdmt,
    467sdmt, 486sdmt, 503sdmt, 508sdmt, 522sdmt, 524,
    ran, natsukisdmt, 524, ran, natsuki, ai, kanezakisdmt, 530sdmt, 553sdmt, 570sdmt, 591sdmt, 5e7sdmt,
    605sdmt, 606sdmt, 621sdmt, 689sdmt, 715sdmt, 722sdmt, 722, acme, 11, tentaclessdmt, 731sdmt, 757sdmt, 757, maki

  10. Hmm it looks like your site ate my first comment (it
    was super long) so I guess I’ll just sum it up what I submitted and say,
    I’m thoroughly enjoying your blog. I too am an aspiring blog writer but
    I’m still new to everything. Do you have
    any helpful hints for novice blog writers? I’d definitely appreciate it.

  11. hello there and thank you for your information – I have
    definitely picked up something new from right here.

    I did however expertise some technical points using this website, since I experienced to reload the
    site lots of times previous to I could get it to
    load correctly. I had been wondering if your web host is OK?
    Not that I’m complaining, but sluggish loading instances times will very frequently affect your placement in google and
    could damage your high quality score if advertising and marketing with Adwords.
    Anyway I am adding this RSS to my e-mail and could look
    out for much more of your respective exciting content.
    Make sure you update this again very soon.

  12. Hello! I could have sworn I’ve been to this blog before but after browsing through some of the post I realized it’s new to me. Anyways, I’m definitely happy I found it and I’ll be book-marking and checking back frequently!

  13. Hello! I could have sworn I’ve been to this blog before but after browsing through some of the post I realized it’s new to me. Anyways, I’m definitely happy I found it and I’ll be book-marking and checking back frequently!

  14. I was suggested this website by my cousin.
    I’m not sure whether this post is written by him as no
    one else know such detailed about my trouble. You’re incredible!
    Thanks!

  15. I was curious if you ever considered changing the structure of your blog?
    Its very well written; I love what youve got to say.
    But maybe you could a little more in the way of content
    so people could connect with it better. Youve
    got an awful lot of text for only having 1 or two pictures.
    Maybe you could space it out better?

  16. Taxi moto line
    128 Rue la Boétie
    75008 Paris
    +33 6 51 612 712  

    Taxi moto paris

    Good post! We are linking to this particularly great article on our website.
    Keep up the great writing.

  17. M.E.C Mon Electricien Catalan
    44 Rue Henry de Turenne
    66100 Perpignan
    0651212596

    Electricien Perpignan

    Everything is very open with a clear explanation of the challenges.
    It was definitely informative. Your site is very helpful.

    Thank you for sharing!

  18. Independance Immobilière – Agence Dakar Sénégal
    Av. Fadiga, Immeuble Lahad Mbacké
    BP 2975 Dakar
    +221 33 823 39 30

    Agence Immobilière Dakar

    Hey There. I found your blog using msn. This is a really well written article.
    I’ll be sure to bookmark it and return to read more of your useful info.
    Thanks for the post. I will definitely comeback.

  19. Its like you learn my mind! You appear to know
    so much approximately this, such as you wrote the e book
    in it or something. I feel that you just could do with
    a few % to power the message house a little bit, however instead of that, that is great blog.
    A great read. I’ll certainly be back.

  20. I lоved аs much as you will receive carried out rіght here.
    The sketch iss attractiᴠe, ʏour authored subject matter stylish.
    nonetһeless, you command get bought an edginess oveг that you ѡish ƅe deⅼivering the
    followіng. unwell uhquestionably come more formerly ɑgain since exactly the same nearly very
    often inside case you shield this increase. http://howtopatentaninvention.lowescouponn.com/car-purchasing-tips-getting-your-new-or-made-use-of-cars-and-truck

  21. We are a bunch of volunteers and starting a brand new scheme in our community.
    Your website offered us with useful information to work on. You’ve performed an impressive job and our entire neighborhood can be
    thankful to you.

  22. I have been browsing online more than 2 hours today, yet I never found any interesting article like yours.
    It’s pretty worth enough for me. Personally, if all web owners and bloggers made
    good content as you did, the web will be much more useful
    than ever before.

  23. A person necessarily lend a hand to make severely posts
    I’d state. That is the first time I frequented your web
    page and so far? I amazed with the analysis you made to make this
    actual post extraordinary. Magnificent task!

  24. Its such as you learn my thoughts! You appear to know so much about this, such as you wrote the guide in it or something.
    I believe that you just can do with a few percent to pressure the message
    house a little bit, but other than that,
    that is fantastic blog. A fantastic read. I will certainly be back.

  25. It’s appropriate time to make some plans for
    the future and it’s time to be happy. I’ve learn this publish and if I could I desire to counsel you some
    attention-grabbing issues or advice. Perhaps you could write next articles regarding this article.
    I wish to read more things approximately it!

  26. Hi there, I found your web site by means of Google even as looking for a comparable subject, your website came up, it appears great.
    I have bookmarked it in my google bookmarks.
    Hello there, simply was aware of your blog via Google, and located that it’s really informative.
    I’m gonna be careful for brussels. I’ll be grateful in the event
    you continue this in future. Lots of other people might be benefited from your writing.
    Cheers!

  27. My partner and I absolutely love your blog and find almost all of your post’s to be just
    what I’m looking for. Does one offer guest writers to
    write content for yourself? I wouldn’t mind writing a post or
    elaborating on a few of the subjects you write with regards to here.
    Again, awesome web log!

  28. Howdy just wanted to give you a quick heads up. The words in your content seem
    to be running off the screen in Ie. I’m not
    sure if this is a formatting issue or something to do with internet browser compatibility but I figured I’d post to let you know.

    The design look great though! Hope you get the problem fixed
    soon. Kudos

  29. 먹튀사이트 검증사이트 먹튀폴리스입니다.
    먹튀폴리스는 신규는 물론 오픈된 먹튀사이트를
    철저히 먹튀검증하여 먹튀없는 시대를 만들어가고 있습니다.
    먹튀폴리스를 사랑하는 여러분의 많은 호응바랍니다.
    여러분의 충실한 먹튀검증 사이트가 되도록 노력하겠습니다.

  30. I really like your blog.. very nice colors & theme.
    Did you make this website yourself or did you hire someone
    to do it for you? Plz reply as I’m looking to create my own blog and would like to find out where u got this from.
    appreciate it

  31. Ꮤhat i do not realize is in fact how you’re not actuɑlly much more welⅼ-favored tһan yⲟuu migһt bbe now.

    You are so intelligent. You understand thus considerably relating
    to this matter, mɑde me individuaⅼly imagіne it from a
    lot oof varied angles. Its like women and men aren’t involved except it iss somethіng tօ do witһ Girl ցaga!
    Y᧐ur personal stuffs outstanding. Alll the time take caгe of it up! http://soho.nple.com/info/1383525

  32. Hey! This is kind of off topic but I need some help from an established blog.
    Is it difficult to set up your own blog? I’m not very techincal but
    I can figure things out pretty quick. I’m thinking about creating my own but I’m not sure where
    to begin. Do you have any points or suggestions?
    With thanks

  33. Hey there woild yⲟu mind stating which blog platfoгm you’rе working
    with? I’m going to strart mʏ own blog inn the
    near future but I’m having a difficսlt tіme makinhg ɑ Ԁecision betwee BlogᎬngine/Wordpress/B2evolutіon and Drupal.
    Thee reason I ask is because your deѕign ѕeems ԁifferent
    then most blogs and I’m loolking for sοmething unique.
    P.S Sоrry for bеing off-topic but I had tⲟ ask! https://www.aarohinews.com/forums/users/adelinez12/edit/?updated=true/users/adelinez12/

  34. Its like you read my mind! You seem to know a lot about this, like you wrote the book
    in it or something. I think that you could do with a few pics to drive the message
    home a bit, but other than that, this is excellent blog. An excellent read.
    I will certainly be back.

  35. Greetings! I know this is kind of off topic but I was wondering which blog platform are
    you using for this website? I’m getting fed up of WordPress because I’ve had issues
    with hackers and I’m looking at options for another platform.
    I would be awesome if you could point me in the direction of a good
    platform.

  36. Greate pieces. Keep posting such kind of info on your blog.
    Im really impressed by it.
    Hey there, You have performed a fantastic job. I’ll certainly digg it and in my view suggest to my friends.
    I am sure they’ll be benefited from this website.

  37. It’s appropriate time to make some plans for the future and it’s time to be happy.

    I have read this post and if I could I desire to
    suggest you few interesting things or suggestions.
    Perhaps you could write next articles referring to this article.
    I want to read more things about it!

  38. Hey there ould you mind letting me know which webhost you’re working
    with? I’ve loaded your blog in 3 completely different web browsers and I must say this blog loads a lot quicker then most.
    Can you recommend a good internet hosting provider aat a reasonable price?
    Thank you, I appreciate it!

    Here is my website: slots tournaments

  39. Its like you reаd my mind! You seem to know
    a lot about this, lіke you wrote the book in іt or something.
    I think that yοu could do wіth a few pics to
    drive the message home a bіt, but instead of that, tһis is
    magnificent blog. An excellent read. I’ll definitеly be back.

    Take a look at my blog :: Bokep Jepang Paksa

  40. My developer is trying to convince me to move to .net from PHP.
    I have always disliked the idea because of the expenses. But he’s
    tryiong none the less. I’ve been using WordPress on a number of websites for about a year and
    am anxious about switching to another platform. I have heard very good things about blogengine.net.
    Is there a way I can import all my wordpress posts into it?
    Any kind of help would be greatly appreciated!

  41. Today, I went to the beachfront with my children. I found a sea shell and gave it to my 4 year old daughter and said “You can hear the ocean if you put this to your ear.” She placed the shell
    to her ear and screamed. There was a hermit crab inside and it pinched her ear.
    She never wants to go back! LoL I know this is completely
    off topic but I had to tell someone!

  42. Мy programmer is trying to convince me to move tⲟ .net from PHP.
    I have always disliked the idea Ьecause of the costs.
    But he’s trryiong nlne the less. Ӏ’ve been using Movable-type on a vaгdiеty ᧐f websіtes for aƄout a
    year and am nervoսs about switсhing to another pⅼatform.
    I have heard very ɡood thinvs aƅout blogengine.net.
    Is tһere a way I can transfer all mу wordlress postѕ ihto it?

    Anyy help woᥙld Ьe really appreciated! http://foro.euskaltel.com/User-morianisvh

  43. Hi! I’m at work browsing your blog from my new iphone 3gs!
    Just wanted to say I love reading through your blog and look forward to all your posts!
    Carry on the excellent work!

  44. Very nice post. I just stumbled upon your blog and
    wished to say that I have really enjoyed browsing your blog posts.
    In any case I will be subscribing to your feed and I hope you write again very
    soon!